DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Exd2

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_598559.2 Gene:Exd2 / 97827 MGIID:1922485 Length:650 Species:Mus musculus


Alignment Length:329 Identity:64/329 - (19%)
Similarity:125/329 - (37%) Gaps:87/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KTEKLAMEE-ENPPKRRSSRLTRSTRSMAEDGSPSPEKEKP----------EKLPFIKYKGAIK- 131
            ||.::..:: :.|.:.:..:.....:...:...|.|:::.|          ::|||    ||:: 
Mouse    34 KTSRVMQQQPQQPQQPQQPQPQPQPQPQPQPEHPQPQQQVPGGREWPPPEDDQLPF----GALRA 94

  Fly   132 -------------YFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKSAVIQIC 183
                         ..|.||:  |..:.:..:::::.::...:..|.|| .:.:......:::|:.
Mouse    95 PRASWEERILQAEVVTVSQE--AEWNQIQPFLKRELEDFPVLGIDCEW-VNLEGKASPLSLLQMA 156

  Fly   184 VDEKCCYIYQLTNV----KKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCV 244
            .....|.:.:|..:    :.||..|:.::....:...||....|..||.:|:..:     :..|:
Mouse   157 SPSGFCALVRLPRLIYGGRTLPRTLLDILADGAILKVGVGCSEDANKLLQDYGLI-----VRGCL 216

  Fly   245 DL---------GLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAI 300
            ||         .:.||.:       ||:.|...|....:|||..:|.|.|....|.|:|:.|||.
Mouse   217 DLRYLAMKQGNNILCNGL-------SLKSLAETILNFPLDKSLLLRCSNWDAENLTEDQVTYAAR 274

  Fly   301 DVYIGQVIY------------------------RELER-REKVKIKNEEE-----FKEKNGDAAF 335
            |..|...::                        :.||| |..|.|....:     .:|.||:|..
Mouse   275 DAQISVALFLHLLGYPFSRDSYEEESTDQINWQKALERCRNMVDIPFRSKGLGRLVEEVNGEALE 339

  Fly   336 KAMK 339
            ..:|
Mouse   340 SQLK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 39/208 (19%)
Exd2NP_598559.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..89 7/54 (13%)
WRN_exo 111..287 CDD:176653 41/190 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..373 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.