DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT1G56310

DIOPT Version :10

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_176027.2 Gene:AT1G56310 / 842084 AraportID:AT1G56310 Length:589 Species:Arabidopsis thaliana


Alignment Length:216 Identity:54/216 - (25%)
Similarity:94/216 - (43%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAF---------DMEWPFSF 170
            |.:..::.|::     |.|....|:|  .:||: ||::..:.....:|         |.||..::
plant   335 KAREAEVAFVE-----KSFLRLNDLA--VEDVV-WVDEVNELRKATSFLEGCRVVGIDCEWKPNY 391

  Fly   171 QTG--PGKSAVIQICVDEKCCYIYQLTNVKK-------LPAALVALINHPKVRLHGVNIKNDFRK 226
            ..|  ..|.:::||..|.|   |:.|..:|.       |...|..::........|.|.:.|.::
plant   392 IKGSKQNKVSIMQIGSDTK---IFILDLIKLYNDASEILDNCLSHILQSKSTLKLGYNFQCDIKQ 453

  Fly   227 LARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLD 291
            ||..:.::......:..:|:....||  ..||   |..||..|...:::|::  |.|.|...||.
plant   454 LALSYGDLKCFERYDMLLDIQNVFNE--PFGG---LAGLTKKILGVSLNKTR--RNSDWEQRPLS 511

  Fly   292 ENQLMYAAIDVYIGQVIYREL 312
            :|||.|||:|..:...|:|.:
plant   512 QNQLEYAALDAAVLIHIFRHV 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 PLN02967 16..>114 CDD:215521
WRN_exo 142..314 CDD:176653 48/189 (25%)
AT1G56310NP_176027.2 mut-7_like_exo 366..534 CDD:176655 44/177 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.