DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT5G48350

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_199646.1 Gene:AT5G48350 / 834888 AraportID:AT5G48350 Length:199 Species:Arabidopsis thaliana


Alignment Length:152 Identity:36/152 - (23%)
Similarity:60/152 - (39%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 KSAVIQICVDEKCCYIYQLTNVKK---------LPAALVALINHPKVRLHGVNIKNDFRKLARDF 231
            |:.::|:| |...|.|.||.:..:         ||..|...:|.|:....|:.|.....:|..:|
plant    57 KTVLLQLC-DGDNCLIVQLPDEDEDEGEGEDDNLPLPLFNFLNLPEFTFVGIGINKTMMRLESEF 120

  Fly   232 PEVTAEPLIEKCVDLGLWCNEVCETG-GRWSLERLTNFI-----AKKAMDKSKKVRMSKWHVIPL 290
                           ||.|..|.|.| ..|:|..:|..:     |..:.::.....:..|....|
plant   121 ---------------GLTCKNVVEIGPATWNLTNMTTDVKFRISAIVSTERPSNAVLEDWEKFVL 170

  Fly   291 DENQLMYAAIDVY----IGQVI 308
            ::||:..||.:.|    ||.::
plant   171 NKNQIKLAASNAYFAFGIGNIL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 36/152 (24%)
AT5G48350NP_199646.1 WRN_exo 18..193 CDD:176653 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.