DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT5G24340

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001332242.1 Gene:AT5G24340 / 832504 AraportID:AT5G24340 Length:516 Species:Arabidopsis thaliana


Alignment Length:196 Identity:47/196 - (23%)
Similarity:82/196 - (41%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEW------PFSFQTGPGKSAVIQI------CV 184
            |...|.|  :|....|:|...:...:   |.|.||      ..||.|    ..::|:      ..
plant     8 YLVSSTD--SSEFTHLKWSFTRSTII---ALDAEWKPQHSNTSSFPT----VTLLQVACRLSHAT 63

  Fly   185 DEKCCYIYQLTNVKKLPAALVALIN----HPKVRLHGVNIKNDFRKLARDFPEVTAE---PLIEK 242
            |....::..|::: .|| ::..|:|    .|.|...|...|.|...|:..|.:...|   ..:::
plant    64 DVSDVFLIDLSSI-HLP-SVWELLNDMFVSPDVLKLGFRFKQDLVYLSSTFTQHGCEGGFQEVKQ 126

  Fly   243 CVDLGLWCNEV-CETGGRWSLERLTNF--IAKKAMD--KSKKVRMSKWHVIPLDENQLMYAAIDV 302
            .:|:....|.: .:..||.:.:.:.:.  |.|:.:|  .||:::.|.|...||.|.|.:|||.|.
plant   127 YLDITSIYNYLQHKRFGRKAPKDIKSLAAICKEMLDISLSKELQCSDWSYRPLTEEQKLYAATDA 191

  Fly   303 Y 303
            :
plant   192 H 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 44/186 (24%)
AT5G24340NP_001332242.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.