DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT5G06450

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_196263.1 Gene:AT5G06450 / 830533 AraportID:AT5G06450 Length:206 Species:Arabidopsis thaliana


Alignment Length:207 Identity:38/207 - (18%)
Similarity:82/207 - (39%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TESQDIAASADDVLQWVEKQKDEVV-----PMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQ 193
            |::.|:.:|. |:..::...:::.:     .:.||:.|...|.....|:....          :.
plant    19 TKTIDVGSST-DISPYLSLIREDSILNGNRAVIFDVYWDVGFPETETKTKTSG----------WS 72

  Fly   194 LTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPL-IEKCVDLGLWCNEVCETG 257
            |::||.....|...:..|| ..|. |:|:.:|..|..|  ||...: ||:.:||           
plant    73 LSSVKLSTRNLCLFLRLPK-PFHD-NLKDLYRFFASKF--VTFVGVQIEEDLDL----------- 122

  Fly   258 GRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERREKVKIKN 322
                |......:.:.|::..|....::..::      |.:........:|::.:|.:.:.::.|.
plant   123 ----LRENHGLVIRNAINVGKLAAEARGTLV------LEFLGTRELAHRVLWSDLGQLDSIEAKW 177

  Fly   323 EEEFKEKNGDAA 334
            |:...|:..:||
plant   178 EKAGPEEQLEAA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 31/177 (18%)
AT5G06450NP_196263.1 DnaQ_like_exo 43..203 CDD:415823 34/182 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.