DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and WRNEXO

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_974543.1 Gene:WRNEXO / 827021 AraportID:AT4G13870 Length:288 Species:Arabidopsis thaliana


Alignment Length:248 Identity:69/248 - (27%)
Similarity:114/248 - (45%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PDVK-TEKLAMEEENP---PKRRSSRLTRSTRSMAEDGSPSPEKEKPEKLPFIKYKGAIKYFTES 136
            |.|: |..:...||:|   |.....:|.||..|..........:.:....|.:::.|.|.|...:
plant    40 PTVQATTSVHGHEEDPNQIPNNIRRQLPRSITSSTSYKRFPLSRCRARNFPAMRFGGRILYSKTA 104

  Fly   137 QDIAASADDVLQWVEKQKDE--VVPMAFDMEWPFSFQTG--PGKSAVIQICVDEKCCYIYQLTNV 197
            .::...|..:::.::.::||  :..:..|:||..||:.|  |||.|.:|||||...|.:..:.: 
plant   105 TEVDKRAMQLIKVLDTKRDESGIAFVGLDIEWRPSFRKGVLPGKVATVQICVDSNYCDVMHIFH- 168

  Fly   198 KKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGG--RW 260
            ..:|.:|..||....:...|:.|..|..||..|:     ...|:...||....|:  :.||  :|
plant   169 SGIPQSLQHLIEDSTLVKVGIGIDGDSVKLFHDY-----GVSIKDVEDLSDLANQ--KIGGDKKW 226

  Fly   261 SLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELE 313
            .|..||..:..|.:.|..::|:..|...||.:.||.|||.|.|....:|:.|:
plant   227 GLASLTETLVCKELLKPNRIRLGNWEFYPLSKQQLQYAATDAYASWHLYKVLK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 54/178 (30%)
WRNEXONP_974543.1 WRN_exo 121..279 CDD:176653 52/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2291
OMA 1 1.010 - - QHG60260
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 1 1.000 - - FOG0014344
OrthoInspector 1 1.000 - - oto3879
orthoMCL 1 0.900 - - OOG6_106571
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.