DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT3G12470

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_566424.1 Gene:AT3G12470 / 820426 AraportID:AT3G12470 Length:220 Species:Arabidopsis thaliana


Alignment Length:182 Identity:44/182 - (24%)
Similarity:75/182 - (41%) Gaps:28/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 IAASADDVLQWVE-----KQKDEVVPM--AFDMEW-PFSFQTGPGKSAVIQICVDEKCCYIYQLT 195
            :..:|..:.:|:.     .:...|.|:  ...::| |.|....| ....:|:||..: |.|.||.
plant    30 VTPTASVIRRWIRSVRSYNRNHSVHPLVVGIGVQWRPDSSDPDP-PPKTLQLCVGSR-CLIIQLG 92

  Fly   196 NVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRW 260
            ....||..|...:..||....||....|.:||.:....|.    |.|.:|:.::..:  ..|.|.
plant    93 YNYGLPKVLRTFLADPKTTFVGVWNGQDQKKLEKCRHRVE----IGKLLDIRMFVRD--SRGARM 151

  Fly   261 ---SLERLTNFIAKKAMDK-----SKKVRMSKWHVIPLDENQLMYAAIDVYI 304
               |.|:    |.|:.:.:     ...:.||.|.|..|:..|::.|:|:.|:
plant   152 CFCSFEQ----IVKERLGRVGVRLDPAICMSDWGVYNLNHYQVLQASIESYV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 44/179 (25%)
AT3G12470NP_566424.1 WRN_exo 31..206 CDD:176653 44/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.