DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT3G12460

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187852.1 Gene:AT3G12460 / 820425 AraportID:AT3G12460 Length:242 Species:Arabidopsis thaliana


Alignment Length:176 Identity:40/176 - (22%)
Similarity:76/176 - (43%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LQWVE----------KQKDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLP 201
            :||..          ..:.:..|.::..:.|..|.:....:..:|:||..: |.|.||...:::|
plant    61 VQWTPSGYHPASPPVSYRSDSSPDSYRSDSPPVFYSSDPPADTLQLCVGNR-CIIIQLRYCERVP 124

  Fly   202 AALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLT 266
            ..|...:........|:....|..||.|...::.    |.:.:||..:   |.::.||.|   :.
plant   125 QVLRNFLADRDNTFVGIWNSQDAGKLERSRHQLE----IAELMDLREF---VSDSSGRRS---MY 179

  Fly   267 NFIAKKAMDKS---------KKVRMSKWHVIPLDENQLMYAAIDVY 303
            |:..:|.::::         ::|.||.|.|..|..:|::.|:||||
plant   180 NYSLEKIVEENLGYPGVRLDREVSMSDWRVYNLSYDQILQASIDVY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 40/176 (23%)
AT3G12460NP_187852.1 WRN_exo 31..238 CDD:176653 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.