DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT3G12430

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187849.1 Gene:AT3G12430 / 820422 AraportID:AT3G12430 Length:238 Species:Arabidopsis thaliana


Alignment Length:129 Identity:35/129 - (27%)
Similarity:58/129 - (44%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 IQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCV 244
            :|:||..: |.|.||::.:::|..|...:........|:....|..||.|...|:....|:    
plant   104 LQLCVGNR-CIIIQLSHCERVPQVLRNFLADRDYTFVGIWNSQDAGKLKRSKHELEIAVLL---- 163

  Fly   245 DLGLWCNEVCETGG----RWSLERLT-NFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVY 303
            ||..:   |.::.|    |.|.|::. ..:....:...:||..|.|.|..|...|::.|:||||
plant   164 DLRKF---VSDSSGRTMKRCSFEKIVEENLGHSGVRLDRKVSRSDWRVYDLRYVQILQASIDVY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 35/129 (27%)
AT3G12430NP_187849.1 WRN_exo 31..237 CDD:176653 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.