DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT3G12420

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187848.2 Gene:AT3G12420 / 820421 AraportID:AT3G12420 Length:185 Species:Arabidopsis thaliana


Alignment Length:135 Identity:29/135 - (21%)
Similarity:51/135 - (37%) Gaps:22/135 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IKYKGAIKYFTESQDIAASADDVLQWV------------EKQKDEVVPMAFDMEWP----FSFQT 172
            ::|.....|:.:...:...    :||.            ....|...|.::|...|    :|...
plant    44 VEYNNCRPYYLQPLVVGVG----VQWTPPVSYDANPPPDRYYSDHHPPRSYDPNPPPNRYYSDHH 104

  Fly   173 GPGKSA-VIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTA 236
            .|...| .:|:||..: |.|.||.:..::|.:|.:.:..|.....||....|..||||...::..
plant   105 PPHPPADTLQLCVGNQ-CLIIQLCHCDQVPTSLRSFLTDPNTTFVGVWNSQDAGKLARSKHQLEI 168

  Fly   237 EPLIE 241
            ..|::
plant   169 GKLLD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 27/117 (23%)
AT3G12420NP_187848.2 DnaQ_like_exo 105..>185 CDD:299142 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.