DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT3G12410

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187847.1 Gene:AT3G12410 / 820420 AraportID:AT3G12410 Length:230 Species:Arabidopsis thaliana


Alignment Length:209 Identity:44/209 - (21%)
Similarity:91/209 - (43%) Gaps:43/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AIKYFTESQDIAASADD--VLQWV------EKQKDEVVPMAFDMEW-PFSFQTGP---------- 174
            ::.:|.:...:..:.|.  :.:|:      .:.....:.:...::| |||:.:.|          
plant    19 SVDFFGDEFIVTVTWDSSVISRWIRNVLFNNRFSSHPLVVGVGVQWTPFSYYSDPRPNNYYADPP 83

  Fly   175 -------GKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFP 232
                   ..:.::|:||..: |.|.||....::|..|.:.:..|:....||....|..||||...
plant    84 PIRYYSDNPADILQLCVGNR-CLIIQLGYCDQVPNNLRSFLADPETTFVGVWNGQDAGKLARCCH 147

  Fly   233 EVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNF--IAKKAMD-----KSKKVRMSKWHVIPL 290
            ::.    |.:.:|:..:   |.::.|| |:.| ::|  |.::.|.     ...::.||.|....|
plant   148 QLE----IGELLDIRRY---VTDSWGR-SMRR-SSFEEIVEECMGYQGVMLDPEISMSDWTAYDL 203

  Fly   291 DENQLMYAAIDVYI 304
            |.:|::.|::|.|:
plant   204 DLDQILQASLDAYV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 43/196 (22%)
AT3G12410NP_187847.1 WRN_exo 50..223 CDD:176653 41/178 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.