DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and AT2G36110

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_181155.1 Gene:AT2G36110 / 818184 AraportID:AT2G36110 Length:239 Species:Arabidopsis thaliana


Alignment Length:239 Identity:48/239 - (20%)
Similarity:90/239 - (37%) Gaps:76/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IKYFTES--QDIAASADDVLQWVEK-------QKDEVVPMAFDMEWPFSFQTGPGKS----AVIQ 181
            |.:|.|.  ..:..:...:.:|:..       :....:.:..|::|.      ||.|    .::|
plant    19 IDFFGERLIVTVTHTTSTIRRWIHSIRFFSRLRSSHPLVVGLDVQWT------PGGSDPPPDILQ 77

  Fly   182 ICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEV------------ 234
            :||..: |.|.||::.|::|..|.:.:....:...||....|..||.|...::            
plant    78 LCVGNR-CLIIQLSHCKRIPEVLRSFLEDETITFVGVWNSQDQGKLERFRHQLEIWRLLDIRHYL 141

  Fly   235 -------TAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDE 292
                   :.|.::|:|                         :..|.:.|.|::.||.|....|..
plant   142 PTRLLNSSFEKIVEEC-------------------------LGYKGVRKDKEICMSNWGARSLSH 181

  Fly   293 NQLMYAAIDVY------IGQVIYRELERREKVKIKNEEEFKEKN 330
            :|::.|:.|||      :.:.|::|   |..||   |..:||.:
plant   182 DQIVQASDDVYVCCKLGVKECIWKE---RSNVK---ERIWKESS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 39/207 (19%)
AT2G36110NP_181155.1 WRN_exo 31..202 CDD:176653 37/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.