DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and WRN

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_000544.2 Gene:WRN / 7486 HGNCID:12791 Length:1432 Species:Homo sapiens


Alignment Length:267 Identity:85/267 - (31%)
Similarity:132/267 - (49%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AAKRKNLDTPDVKTEKLAMEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEKPEKLPFIKYKGAIK 131
            |.:||..:..:|:.::.|:||.....|         :|:.||           .|||:::.|:|.
Human    10 AQQRKCPEWMNVQNKRCAVEERKACVR---------KSVFED-----------DLPFLEFTGSIV 54

  Fly   132 YFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGP-GKSAVIQICVDEKCCYIYQLT 195
            |..::.|.:..::|:.  :.....:||  .||||||..:..|. ||.|:||:||.|..||::.::
Human    55 YSYDASDCSFLSEDIS--MSLSDGDVV--GFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVS 115

  Fly   196 NVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLG---LWCNEVCETG 257
            ::...|..|..|:.:..|:..||.|:.|..||.||| ::..:..:| ..|:.   |.|.|.    
Human   116 SMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDF-DIKLKNFVE-LTDVANKKLKCTET---- 174

  Fly   258 GRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELE----RREKV 318
              |||..|...:..|.:.|.|.:|.|.|...||.|:|.:|||.|.|.|.:|||.||    ..::.
Human   175 --WSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRF 237

  Fly   319 KIKNEEE 325
            .|..|||
Human   238 AINKEEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 63/179 (35%)
WRNNP_000544.2 Interaction with WRNIP1. /evidence=ECO:0000250 2..277 85/267 (32%)
RNaseD_like 61..229 CDD:176650 63/179 (35%)
2 X 27 AA tandem repeats of H-L-S-P-N-D-N-E-N-D-T-S-Y-V-I-E-S-D-E-D-L-E-M-E-M-L-K 424..477
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..529
recQ_fam 538..1010 CDD:129701
DEAD 551..712 CDD:278688
DEAH box 668..671
HELICc 759..867 CDD:238034
RecQ_Zn_bind 872..939 CDD:292742
RQC 958..1051 CDD:214936
Interaction with DNA. /evidence=ECO:0000269|PubMed:20159463 987..993
HRDC 1156..1229 CDD:128635
HTH_40 1261..1351 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6735
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.