DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and wrn

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_009302246.2 Gene:wrn / 569495 ZFINID:ZDB-GENE-070702-2 Length:1387 Species:Danio rerio


Alignment Length:196 Identity:60/196 - (30%)
Similarity:98/196 - (50%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 EKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKS-AVIQI 182
            :.||::::.|.:.|..|..|.:..::|:...:....    .:.||:|||.||..|..|. |::|:
Zfish    30 DHLPYLEFGGTVVYSQERHDCSFLSEDLRSALSSGS----AVGFDLEWPPSFTKGKTKKVAMVQL 90

  Fly   183 CVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLG 247
            |..|..||::.::::...|..|...:....:...||.|:.|..||..|:     :..::..|||.
Zfish    91 CASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDY-----DIKLKNIVDLS 150

  Fly   248 LWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYREL 312
            ...||......:|||:.|...:.||.:.|.|.||.|.|....|.|:|..|||.|.|.|.:||::|
Zfish   151 DLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKL 215

  Fly   313 E 313
            :
Zfish   216 Q 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 54/173 (31%)
wrnXP_009302246.2 WRN_exo 48..217 CDD:176653 55/178 (31%)
DEXDc 433..901 CDD:331760
HRDC 1045..1116 CDD:322002
HTH_40 1155..1242 CDD:316965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7356
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.