Sequence 1: | NP_001163646.1 | Gene: | WRNexo / 42208 | FlyBaseID: | FBgn0038608 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009302246.2 | Gene: | wrn / 569495 | ZFINID: | ZDB-GENE-070702-2 | Length: | 1387 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 60/196 - (30%) |
---|---|---|---|
Similarity: | 98/196 - (50%) | Gaps: | 10/196 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 EKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKS-AVIQI 182
Fly 183 CVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLG 247
Fly 248 LWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYREL 312
Fly 313 E 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
WRNexo | NP_001163646.1 | WRN_exo | 142..314 | CDD:176653 | 54/173 (31%) |
wrn | XP_009302246.2 | WRN_exo | 48..217 | CDD:176653 | 55/178 (31%) |
DEXDc | 433..901 | CDD:331760 | |||
HRDC | 1045..1116 | CDD:322002 | |||
HTH_40 | 1155..1242 | CDD:316965 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 95 | 1.000 | Domainoid score | I7356 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |