DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and EXD2

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001180289.1 Gene:EXD2 / 55218 HGNCID:20217 Length:621 Species:Homo sapiens


Alignment Length:288 Identity:70/288 - (24%)
Similarity:116/288 - (40%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KRRSSRLTRSTRSMAED--GS---PSPEKEK-PEKLPFIKYKGAI---KYFTESQDIAASADDVL 147
            :||.|:.:..|:...:.  ||   |.||.:: ....|...:|..|   |..|.||:  |..|.:.
Human    30 RRRRSKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERILKAKVVTVSQE--AEWDQIE 92

  Fly   148 QWVEKQKDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNV----KKLPAALVALI 208
            ..:..:.::...:..|.|| .:.:......:::|:......|.:.:|..:    |.||..|:.::
Human    93 PLLRSELEDFPVLGIDCEW-VNLEGKASPLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDIL 156

  Fly   209 NHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDL---------GLWCNEVCETGGRWSLER 264
            ....:...||....|..||.:|:..|     :..|:||         .|.||.:       ||:.
Human   157 ADGTILKVGVGCSEDASKLLQDYGLV-----VRGCLDLRYLAMRQRNNLLCNGL-------SLKS 209

  Fly   265 LTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYREL----ERREKVKIKNEEE 325
            |...:....:|||..:|.|.|....|.|:|::|||.|..|...::..|    ..|.....||::.
Human   210 LAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDH 274

  Fly   326 ------FKEKNG--DAAF--KAMKALGE 343
                  .::..|  |..|  |.|..|||
Human   275 SSWRKVLEKCQGVVDIPFRSKGMSRLGE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 42/188 (22%)
EXD2NP_001180289.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..68 8/33 (24%)
WRN_exo 82..258 CDD:176653 44/190 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..343 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.