Sequence 1: | NP_001163646.1 | Gene: | WRNexo / 42208 | FlyBaseID: | FBgn0038608 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016870350.1 | Gene: | EXD3 / 54932 | HGNCID: | 26023 | Length: | 1080 | Species: | Homo sapiens |
Alignment Length: | 279 | Identity: | 59/279 - (21%) |
---|---|---|---|
Similarity: | 106/279 - (37%) | Gaps: | 73/279 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 KLAMEEENPPKRRSSRLTR-STRSMAEDGSPSPE----KEKPEKLPFIKYKGAIKYFTESQDIAA 141
Fly 142 SADDVL--QWVEKQKDEVVPMAFDMEW-PFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLP-- 201
Fly 202 ------AALVA-LINHPKVRLHGVNIKNDFRKLARDFPEV------------------------- 234
Fly 235 TAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAA 299
Fly 300 IDVY----IGQVIYRELER 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
WRNexo | NP_001163646.1 | WRN_exo | 142..314 | CDD:176653 | 45/212 (21%) |
EXD3 | XP_016870350.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1295758at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |