DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and exd2

DIOPT Version :10

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012823866.2 Gene:exd2 / 549208 XenbaseID:XB-GENE-5752408 Length:642 Species:Xenopus tropicalis


Alignment Length:162 Identity:38/162 - (23%)
Similarity:70/162 - (43%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WVEKQKD-EVVP-MAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKK----LPAALVAL 207
            |:..:|| :|.| :..|.|| .|.....|..:::|:......|.:.:|..:..    :|..|:.|
 Frog    98 WLLLKKDLDVYPVLGMDCEW-VSVDGKAGPVSLLQMASYSGFCVLVRLPQLTSSGCTIPKTLLEL 161

  Fly   208 INHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWC----NEVCETGGRWSLERLTNF 268
            :.:..|...||....|..||..|:     ...::.|||:....    .::.:  ...||:.|:..
 Frog   162 LANNSVLKVGVGCWEDSSKLFNDY-----GLSVKGCVDIRYLAMRHRRDILQ--NTLSLKSLSET 219

  Fly   269 IAKKAMDKSKKVRMSKWHVIPLDENQLMYAAI 300
            |....:|||.::|.|.|......::|:..::|
 Frog   220 ILSFPLDKSFQLRCSNWDAEEFTQDQVKVSSI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 PLN02967 16..>114 CDD:215521
WRN_exo 142..314 CDD:176653 38/162 (23%)
exd2XP_012823866.2 WRN_exo 85..294 CDD:176653 38/162 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.