DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Exd2

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001247048.1 Gene:Exd2 / 41374 FlyBaseID:FBgn0037901 Length:583 Species:Drosophila melanogaster


Alignment Length:179 Identity:47/179 - (26%)
Similarity:74/179 - (41%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DDVLQWV----EKQKDEVVPMAFDMEWPFSFQTGPGKS--AVIQICVDEKCCYIYQLTNVKKLPA 202
            |...|||    :........:.||.||   ...|..:.  |::|:......|.:::|.::|::|.
  Fly    60 DPTTQWVLNELKNHCQTFKVLGFDCEW---ITVGGSRRPVALLQLSSHRGLCALFRLCHMKQIPQ 121

  Fly   203 ALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGR--WSLERL 265
            .|..|:....|...||..:.|..||:.|:....|..|     ||..    :|...|.  ..|.:|
  Fly   122 DLRELLEDDSVIKVGVAPQEDAMKLSHDYGVGVASTL-----DLRF----LCVMAGHKPEGLGKL 177

  Fly   266 TNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELER 314
            :.......:||..::..|.|....|:..||.|||.|..:...||::|.|
  Fly   178 SKTHLNYTLDKHWRLACSNWEAKTLEPKQLDYAANDALMAVAIYQKLCR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 46/177 (26%)
Exd2NP_001247048.1 WRN_exo 62..226 CDD:176653 45/175 (26%)
Cas8a1_I-A 363..432 CDD:328770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.