DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Exd2

DIOPT Version :10

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650075.1 Gene:Exd2 / 41374 FlyBaseID:FBgn0037901 Length:583 Species:Drosophila melanogaster


Alignment Length:179 Identity:47/179 - (26%)
Similarity:74/179 - (41%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DDVLQWV----EKQKDEVVPMAFDMEWPFSFQTGPGKS--AVIQICVDEKCCYIYQLTNVKKLPA 202
            |...|||    :........:.||.||   ...|..:.  |::|:......|.:::|.::|::|.
  Fly    60 DPTTQWVLNELKNHCQTFKVLGFDCEW---ITVGGSRRPVALLQLSSHRGLCALFRLCHMKQIPQ 121

  Fly   203 ALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGR--WSLERL 265
            .|..|:....|...||..:.|..||:.|:....|..|     ||..    :|...|.  ..|.:|
  Fly   122 DLRELLEDDSVIKVGVAPQEDAMKLSHDYGVGVASTL-----DLRF----LCVMAGHKPEGLGKL 177

  Fly   266 TNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELER 314
            :.......:||..::..|.|....|:..||.|||.|..:...||::|.|
  Fly   178 SKTHLNYTLDKHWRLACSNWEAKTLEPKQLDYAANDALMAVAIYQKLCR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 PLN02967 16..>114 CDD:215521
WRN_exo 142..314 CDD:176653 46/177 (26%)
Exd2NP_650075.1 WRN_exo 62..226 CDD:176653 45/175 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.