DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Nbr

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_610094.1 Gene:Nbr / 35385 FlyBaseID:FBgn0032924 Length:625 Species:Drosophila melanogaster


Alignment Length:299 Identity:68/299 - (22%)
Similarity:95/299 - (31%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NLDTPDVKTEKLAMEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEK-PEK---------LPFIKY 126
            |:|..|...|......:|...:.|             |..||.||: |..         ||    
  Fly   359 NIDPKDCPLEIETQVSQNGAGKAS-------------GWESPGKERCPSSRCDMYLTMDLP---- 406

  Fly   127 KGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYI 191
                   .|...|...||:..:.:...:.|.| :..|.||..|            :|.|.:.|.:
  Fly   407 -------DECLIIVNKADEFDRMLYHLQQECV-IYLDSEWMQS------------VCGDNQLCVL 451

  Fly   192 YQLT--NVKKLPAALVALINHPKVRLHGVNIKN-------------DFRKLARDFPEVTAEPLIE 241
            ...|  ||..:.......:.....||.|.||.|             |...|.|..|......:..
  Fly   452 QIATGHNVYLIDCLARESLRSEHWRLLGANIFNNVNIRKVGFSMVSDLSVLQRSLPLQLRLQMPH 516

  Fly   242 KCVDL-GLWC-------------NEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDE 292
            ..:|| .||.             ..|...|.  :|..|:.....|.::||.  :.|.|...||..
  Fly   517 HYLDLRNLWLELKKQRFGVELPFGNVNRAGD--ALTDLSLACLGKKLNKSN--QCSNWANRPLRR 577

  Fly   293 NQLMYAAIDVYIGQVIYREL-ERREKVKIKNEEEFKEKN 330
            .|::|||||.....:||..| ||...::...|:.....|
  Fly   578 EQILYAAIDARCLMLIYNTLIERVSFIQAVIEKSIASNN 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 48/201 (24%)
NbrNP_610094.1 mut-7_like_exo 413..599 CDD:176655 48/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13620
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.