DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and exd2

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001107878.1 Gene:exd2 / 334455 ZFINID:ZDB-GENE-030131-6387 Length:617 Species:Danio rerio


Alignment Length:294 Identity:66/294 - (22%)
Similarity:108/294 - (36%) Gaps:59/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AAKRKNLDTPDVKTEKLAMEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEKP-------EKLPFI 124
            |.|:|........||.:..:.:            :....:::.|..|..:||       |:.|.:
Zfish    30 AQKKKKTLASAAPTEPILAQRD------------AVLQPSQEPSAPPVSQKPLRAHTLLEEPPVV 82

  Fly   125 KYKGAIKYFTESQDIAASADDVLQWVEKQKD-EVVP-MAFDMEW----PFSFQTGPGKSAVIQIC 183
                          |::..|....|...||| .:.| :..|.||    ..|.:......:::|:.
Zfish    83 --------------ISSPQDWDNLWPALQKDLSMYPVLGLDCEWVKRVRVSVKGRVSAVSLLQLS 133

  Fly   184 VDEKCCYIYQLTNVK--KLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKC-VD 245
            .....|.:.:|...:  :||.:|:.|:...:|...||....|.::||:|      ..|...| ||
Zfish   134 SFTGRCVLVRLLAFQNAQLPKSLIVLLRDQRVLKVGVGCYEDGKRLAQD------HGLTLSCTVD 192

  Fly   246 LGLWC----NEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQ 306
            |....    .:...|.| .||:.|...:....:|||.::|.|.|....|...|:.|||.|..|..
Zfish   193 LRYLALRRSKQAVLTNG-LSLKSLAEDLLNVTLDKSVELRCSDWEAEELSPEQITYAARDAQISI 256

  Fly   307 VIYRELERREKVKIKNEEEFKEKNGDAAFKAMKA 340
            .::..|..      .|.|......|:|.|..:.|
Zfish   257 ALFFHLLG------MNTERHLPAEGEAVFLHLSA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 48/184 (26%)
exd2NP_001107878.1 WRN_exo 83..263 CDD:176653 48/186 (26%)
RRXRR 357..>399 CDD:290939
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.