DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Wrn

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_006253318.1 Gene:Wrn / 290805 RGDID:1564788 Length:1400 Species:Rattus norvegicus


Alignment Length:271 Identity:82/271 - (30%)
Similarity:135/271 - (49%) Gaps:19/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEKPE-KLPFIKYKGAIKYFTESQDIAASADDVLQ 148
            ||..:..::....::...:|.|.....|.:|...| .|||:::.|::.|..|:.|.:..::|:. 
  Rat     1 METTSLRRKFPEWMSTQNKSCATQEKASIQKSVLEDDLPFLEFTGSVVYSYEASDCSFLSEDIS- 64

  Fly   149 WVEKQKDEVVPMAFDMEWPFSFQTGP-GKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPK 212
             :.....:||  .||||||..::.|. .:.||||:||.|..||::.::::...|..|..|:.:..
  Rat    65 -MHLSDGDVV--GFDMEWPPIYKQGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKS 126

  Fly   213 VRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKS 277
            :|..||.|:.|..||.|||     :..:|..|:|....|...:....|||..|...:..|.:.|.
  Rat   127 IRKAGVGIEGDQWKLLRDF-----DVKLESFVELTDVANRKLKCAETWSLNGLVKHVLGKQLLKD 186

  Fly   278 KKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELER-REKVKI----KNEEEF---KEKNGDAA 334
            |.:|.|.|...||.|:|.:|||.|.|.|.:||::||. .:.|::    |.||..   .:|..::.
  Rat   187 KSIRCSNWSDFPLSEDQKLYAATDAYAGLIIYQKLENLGDAVQVFALNKAEESLPMEMKKQLNSI 251

  Fly   335 FKAMKALGETF 345
            .:.|:.|...|
  Rat   252 SEEMRDLANHF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 59/172 (34%)
WrnXP_006253318.1 RNaseD_like 55..223 CDD:176650 60/176 (34%)
recQ_fam 502..975 CDD:129701
DEAD 515..676 CDD:278688
HELICc <730..832 CDD:238034
RecQ_Zn_bind 837..904 CDD:292742
RQC 923..1016 CDD:214936
HRDC 1118..1194 CDD:128635
HTH_40 1226..1316 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6532
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.