DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and Wrn

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001116294.1 Gene:Wrn / 22427 MGIID:109635 Length:1401 Species:Mus musculus


Alignment Length:216 Identity:72/216 - (33%)
Similarity:114/216 - (52%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RSTRSMAEDGSPSPEKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDM 164
            :|.|...|:.:...:....:.|||:::.|:|.|..|:.|.:..::|:.  :.....:||  .|||
Mouse    17 QSQRCATEEKACVQKSVLEDNLPFLEFPGSIVYSYEASDCSFLSEDIS--MRLSDGDVV--GFDM 77

  Fly   165 EWPFSFQTGPGKS---AVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRK 226
            |||..::  |||.   ||||:||.|..||::.::::...|..|..|:.:..::..||.|:.|..|
Mouse    78 EWPPIYK--PGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWK 140

  Fly   227 LARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLD 291
            |.|||     :..:|..|:|....||..:....|||..|...:..|.:.|.|.:|.|.|...||.
Mouse   141 LLRDF-----DVKLESFVELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLT 200

  Fly   292 ENQLMYAAIDVYIGQVIYREL 312
            |:|.:|||.|.|.|.:||::|
Mouse   201 EDQKLYAATDAYAGLIIYQKL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 61/174 (35%)
WrnNP_001116294.1 Interaction with WRNIP1. /evidence=ECO:0000269|PubMed:11301316 1..271 72/216 (33%)
RNaseD_like 55..223 CDD:176650 62/178 (35%)
rnd <156..>344 CDD:130455 25/66 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..492
recQ_fam 502..975 CDD:129701
DEAH box 632..635
Interaction with DNA. /evidence=ECO:0000250 952..958
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1041..1106
HRDC 1116..1194 CDD:128635
HTH_40 1223..1317 CDD:379623
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1323..1401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6706
eggNOG 1 0.900 - - E1_KOG4373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.