DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and mut-7

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_499105.1 Gene:mut-7 / 176347 WormBaseID:WBGene00003504 Length:910 Species:Caenorhabditis elegans


Alignment Length:261 Identity:54/261 - (20%)
Similarity:104/261 - (39%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 EKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVP--MAFDMEWPFSFQTG--P 174
            |.|:..::..:|.:..:.|....             ::...||..|  :.||.||..|..|.  .
 Worm   397 ENERRTQIHMVKTESEMNYLCSE-------------IKSLSDEPAPVYVGFDSEWKPSNLTAVHD 448

  Fly   175 GKSAVIQICVDEKCCYIYQLTNVKKLPAA-------LVALINHPKVRLHGVNIKNDFRKLARDFP 232
            .|.|:||:.. :.|.::.....::|...|       ...|.....|::.|.:::||...:| ..|
 Worm   449 SKIAIIQLFF-KNCVWLVDCVELEKANMADDWWQKFASRLFGDSPVKVVGFDMRNDLDAMA-TIP 511

  Fly   233 EVTAEPLIE---KCVDLGLWCNEVCETG--------GRWSLERLTNFIAKKAMDKSKKVRMSKWH 286
            .:.:...||   ...||......||:..        ..:.|..||:::....:||::  :.|.|.
 Worm   512 ALKSSMKIEDTKNAFDLKRLAENVCDIDMEILELPKKTFKLADLTHYLLGLELDKTE--QCSNWQ 574

  Fly   287 VIPLDENQLMYAAIDVYIGQVIYREL----ERREK-------VKIKNEEEFKEKNGDAAFKAMKA 340
            ..||.:.|::|||:|..:....::::    |.:.|       |:..|....|:..|..:::.:|.
 Worm   575 CRPLRKKQIVYAALDAVVVVETFKKILSIVEEKNKDADIEKIVRESNVMAPKKDKGHKSYRKLKT 639

  Fly   341 L 341
            :
 Worm   640 I 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 43/197 (22%)
mut-7NP_499105.1 mut-7_like_exo 404..602 CDD:176655 45/214 (21%)
Mut7-C 665..>775 CDD:302879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.