DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and ZK1098.3

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_499104.1 Gene:ZK1098.3 / 176346 WormBaseID:WBGene00014220 Length:784 Species:Caenorhabditis elegans


Alignment Length:294 Identity:64/294 - (21%)
Similarity:115/294 - (39%) Gaps:51/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AKRKNLD------TPDVKTEKLAMEEENPPKRRSSRL-----TRSTRSMAEDGSPSPEKEKPEKL 121
            |...|:|      .||:|.|.     |||.....:.|     .|:|::..|:.......|:.:|.
 Worm   361 ATYSNIDRNSKYMPPDLKEEL-----ENPTTEMKNGLEKLQALRTTKNCQEEDEQLYVFEEQKKY 420

  Fly   122 PFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEW-PFS-FQTGPGKSAVIQICV 184
            |       |:.....||:     ::|.....:.:|.:.:.:|.|: |:. ......:.|:||:..
 Worm   421 P-------IRIVQNEQDL-----EILLSELGELEEGMYIGYDSEFKPYHLIDVSTSRLAIIQLFF 473

  Fly   185 DEK-----CCYIYQLTNVKKLPAALV-ALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEK- 242
            .:|     |..|..|.:...:...|. .|....|..:.|.:|:.|...:. ..|.:.....||. 
 Worm   474 KDKAWLINCVAIDNLASRDDVWIRLYKGLFESNKFSIVGFDIRQDIEAMF-TVPSINKNFKIENI 537

  Fly   243 ----CV-----DLGLWCNEVCETGGRWS-LERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMY 297
                ||     ::.....::.....:.| |..|.:.:....||||:  :...|...||..||::|
 Worm   538 QNVICVKSLAENVNALSMDILNLSTKTSKLSVLADHLVGLKMDKSE--QCGNWQCRPLRRNQIIY 600

  Fly   298 AAID-VYIGQVIYRELERREKVKIKNEEEFKEKN 330
            |.:| |.:.:|..:.:|...|.::..|:...|.:
 Worm   601 AVMDAVAVFEVFQKIVEVVRKHELDAEKLLVESH 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 40/191 (21%)
ZK1098.3NP_499104.1 mut-7_like_exo 422..617 CDD:176655 43/202 (21%)
Mut7-C 676..>752 CDD:302879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.