DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WRNexo and W04A8.4

DIOPT Version :9

Sequence 1:NP_001163646.1 Gene:WRNexo / 42208 FlyBaseID:FBgn0038608 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001379222.1 Gene:W04A8.4 / 173253 WormBaseID:WBGene00012239 Length:108 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:19/38 - (50%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 MDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRE 311
            :|..|...||.|....|..:||.||.:|..:..:|.::
 Worm    44 LDLHKGETMSDWTNTHLRGDQLRYAIMDTIVMHLIIKQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WRNexoNP_001163646.1 WRN_exo 142..314 CDD:176653 12/38 (32%)
W04A8.4NP_001379222.1 DnaQ_like_exo <27..86 CDD:415823 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1295758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.