powered by:
Protein Alignment WRNexo and W04A8.4
DIOPT Version :9
Sequence 1: | NP_001163646.1 |
Gene: | WRNexo / 42208 |
FlyBaseID: | FBgn0038608 |
Length: | 354 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379222.1 |
Gene: | W04A8.4 / 173253 |
WormBaseID: | WBGene00012239 |
Length: | 108 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 12/38 - (31%) |
Similarity: | 19/38 - (50%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 MDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRE 311
:|..|...||.|....|..:||.||.:|..:..:|.::
Worm 44 LDLHKGETMSDWTNTHLRGDQLRYAIMDTIVMHLIIKQ 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1295758at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.