powered by:
Protein Alignment WRNexo and Y105C5A.1268
DIOPT Version :9
Sequence 1: | NP_001163646.1 |
Gene: | WRNexo / 42208 |
FlyBaseID: | FBgn0038608 |
Length: | 354 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255874.1 |
Gene: | Y105C5A.1268 / 13206052 |
WormBaseID: | WBGene00185102 |
Length: | 59 |
Species: | Caenorhabditis elegans |
Alignment Length: | 32 |
Identity: | 10/32 - (31%) |
Similarity: | 16/32 - (50%) |
Gaps: | 2/32 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 282 MSKWHVIPLDENQLMYA--AIDVYIGQVIYRE 311
||.|....|..:||.|| .:|..:..:|.::
Worm 1 MSDWTDTYLLGDQLRYAVTVMDTIVMHLILKQ 32
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
WRNexo | NP_001163646.1 |
WRN_exo |
142..314 |
CDD:176653 |
10/32 (31%) |
Y105C5A.1268 | NP_001255874.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1295758at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.