powered by:
Protein Alignment CG15803 and Pdzd11
DIOPT Version :9
Sequence 1: | NP_001287388.1 |
Gene: | CG15803 / 42206 |
FlyBaseID: | FBgn0038606 |
Length: | 880 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343313.1 |
Gene: | Pdzd11 / 72621 |
MGIID: | 1919871 |
Length: | 140 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 22/75 - (29%) |
Similarity: | 39/75 - (52%) |
Gaps: | 10/75 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 607 LGISLEGTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRH---IEVVK 668
||.::.|....:.|| :|..::.|....|.| |:.||::|.||:...|.:.| :|::|
Mouse 58 LGFNIRGGKASQLGI------FISKVIPDSDAHRAG-LQEGDQVLAVNDVDFQDIEHSKAVEILK 115
Fly 669 ILKELPARVK 678
..:|:..||:
Mouse 116 TAREISMRVR 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.