DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and Pdzd3

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:353 Identity:83/353 - (23%)
Similarity:125/353 - (35%) Gaps:115/353 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 KSLGISLE---GTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEV 666
            ||.|..|:   |..|          |.:..:.......||| ||.||.:|.||.:.::...:..|
  Rat    58 KSFGFHLQQQLGKAD----------HVVCRVDPGSSAQRQG-LREGDRILAVNNNIVEHEDYAVV 111

  Fly   667 VKILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSESSLYTSST 731
            |:.::....|| |:.....||..|....|..|||...:|..|....|.:::   :.|.....|.|
  Rat   112 VRYIRASGPRV-LLTVLAQHVYDVTRAQQGNEAFPCPTLASGVRPRLCHVV---KDEGGFGFSVT 172

  Fly   732 ATLTDAGA--------AAGGSGGTAG--GGARSKSLENVSGLAL--------------------- 765
                 .||        :|||:...||  .|||   |..|:|:.:                     
  Rat   173 -----HGARGPFWLVLSAGGAAERAGVPPGAR---LLEVNGICVEKFTYNQLNRKLCQSGDRVTL 229

  Fly   766 -------------------------WS--CEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVI--V 801
                                     |:  .:...::|||..|||||.:.:.:.|....|..:  |
  Rat   230 LVAGPEVEEQCHQLGMPLAAPLAEGWALPAKPRCLNIEKGPQGFGFLLREEKGPDGRLGQFLWEV 294

  Fly   802 IRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRPLSASDSNS 866
            ..||....|.     :..||||::|....:.||..:|.||.::|.       |.|..|...|..:
  Rat   295 DPGLPADKAG-----MKAGDRLVAVAGESMDGLGHEETVSRIRAQ-------GSCVSLVVVDPEA 347

  Fly   867 ----------------NSNI-ASPLGDS 877
                            |:.| |:||.::
  Rat   348 DRFFSMVRLSPLLFLENTEIAAAPLAET 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492 21/77 (27%)
PDZ 773..858 CDD:214570 27/86 (31%)
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492 22/80 (28%)
PDZ_signaling 155..232 CDD:238492 17/87 (20%)
PDZ 260..345 CDD:214570 28/96 (29%)
PDZ_signaling 407..472 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.