Sequence 1: | NP_001287388.1 | Gene: | CG15803 / 42206 | FlyBaseID: | FBgn0038606 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178925.1 | Gene: | Pdzd3 / 500986 | RGDID: | 1559807 | Length: | 498 | Species: | Rattus norvegicus |
Alignment Length: | 353 | Identity: | 83/353 - (23%) |
---|---|---|---|
Similarity: | 125/353 - (35%) | Gaps: | 115/353 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 605 KSLGISLE---GTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEV 666
Fly 667 VKILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSESSLYTSST 731
Fly 732 ATLTDAGA--------AAGGSGGTAG--GGARSKSLENVSGLAL--------------------- 765
Fly 766 -------------------------WS--CEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVI--V 801
Fly 802 IRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRPLSASDSNS 866
Fly 867 ----------------NSNI-ASPLGDS 877 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15803 | NP_001287388.1 | PDZ_signaling | 17..89 | CDD:238492 | |
PDZ | 307..393 | CDD:214570 | |||
PDZ_signaling | 605..680 | CDD:238492 | 21/77 (27%) | ||
PDZ | 773..858 | CDD:214570 | 27/86 (31%) | ||
Pdzd3 | NP_001178925.1 | PDZ_signaling | 47..127 | CDD:238492 | 22/80 (28%) |
PDZ_signaling | 155..232 | CDD:238492 | 17/87 (20%) | ||
PDZ | 260..345 | CDD:214570 | 28/96 (29%) | ||
PDZ_signaling | 407..472 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |