DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and CG34375

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:289 Identity:58/289 - (20%)
Similarity:89/289 - (30%) Gaps:133/289 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLR---QTGAQ-VRLIVARPVEPTAIDYQTLACQ 105
            |||.| ::|||.||::...::.|....::|..|:   |:||: |.|::.|.             |
  Fly    39 AERGG-VRLGDTLLELNGADVLGLKISELANRLQDHWQSGAEVVTLMMWRQ-------------Q 89

  Fly   106 APIIPTKLLSDPEELSRHLFQN-------PSFATAAVAAAAAAAAAAGSGSDGDVGGGGVLDVAS 163
            |.|.|.:   ||.|.| |..|:       ..|||.                              
  Fly    90 ANIDPNE---DPAEAS-HAVQHGINQQSLQKFATC------------------------------ 120

  Fly   164 LVGLVRGGPAEGTELSAVEPQPSAAVLQLQQLSELAGDLADFPLPPIPGG---GGHSMVTDSNAG 225
                                        ||.:|:|........:...||.   .||.:..:..:.
  Fly   121 ----------------------------LQHISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSR 157

  Fly   226 QRPCPRLDLDIVPFSILSPPPRPALQMLPLETQWRCVQDQNRHIETVIADSKRKLLANE---DGG 287
            ...||                   :..:||..:.||          :::|....|||..   |||
  Fly   158 SVKCP-------------------VCRVPLGPRGRC----------LLSDKLFTLLAESFPCDGG 193

  Fly   288 S----ASASGSGSPDS-------YMDSPE 305
            .    |::.|.|...|       |.:.|:
  Fly   194 KTNKVAASQGHGKLSSVNKCTNEYHNQPK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 17/47 (36%)
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 17/47 (36%)
RING 129..168 CDD:238093 6/57 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.