DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and CG15617

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:144 Identity:32/144 - (22%)
Similarity:55/144 - (38%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFILVGG--RSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVR 85
            |..:.||  :...:.|..::|.|:|:|.| :::||.:.||.:|.....:..:...:.|:....||
  Fly    44 GMEVTGGIDQFEPLTIVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRKNSRYVR 107

  Fly    86 LIVA-----------------RPVEPTAIDYQTLACQAPI---IPTKLLSDPEELSRHLFQNPSF 130
            :.|.                 :|.:|...|:      .||   .|......|.....:.|..||.
  Fly   108 VYVRGDDDAPGEEDWTCDCWFKPRKPWRRDF------TPIQWTFPWNDRRKPVYKESNCFMVPSK 166

  Fly   131 ATAAVAAAAAAAAA 144
            ....:.|..||.:|
  Fly   167 MEEKIRARRAATSA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 17/67 (25%)
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.