DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and gopc

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_956851.1 Gene:gopc / 326887 ZFINID:ZDB-GENE-030131-5086 Length:455 Species:Danio rerio


Alignment Length:170 Identity:39/170 - (22%)
Similarity:60/170 - (35%) Gaps:63/170 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGNGLGFILVGGRSTGV--VIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQ- 79
            |..|||..:.||:..||  :|..:.|...|||.|.|.:||.:|.:..:|||....::..|:|.| 
Zfish   294 DHEGLGISITGGKEHGVPILISEIHPTQPAERCGGLHVGDAILAVNNINLRDAKHKEAVTILSQQ 358

  Fly    80 ---------------------------TGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDP 117
                                       :|.:.||.:....|.:|.::....           :||
Zfish   359 RGEIEFEVVYVAPEVDSDDENVEYEDDSGHRYRLYLDELEEASAANHNNGT-----------ADP 412

  Fly   118 EEL---SRHLFQNPSFATAAVAAAAAAAAAAGSGSDGDVG 154
            ..|   .:||..|.:                   .:||||
Zfish   413 ASLQAVGKHLVNNRT-------------------ENGDVG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 27/100 (27%)
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
gopcNP_956851.1 PDZ_signaling 285..367 CDD:238492 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.