DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and Cytip

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:283 Identity:65/283 - (22%)
Similarity:116/283 - (40%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 DQNRHIETVIADS------KRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHKNVYG-LG 321
            :.||.|: |:||:      .||.||     .|.:|..|      |...::..||.:.|...| .|
Mouse    37 EDNRRIQ-VLADTVATLPRGRKQLA-----LARSSSLG------DFSWSQRKVVTVEKQDNGTFG 89

  Fly   322 ITVAGYVCEEEDLSGIFVKSII----EGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRN 382
            ..:..|..:.:::....|.::|    |.|.|..:| :|:.|....|:|.|..|.|:.|.|:|:|:
Mouse    90 FEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAG-LQVGDIFANVNGVSTEGFTHKQVVDLIRS 153

  Fly   383 T----------DIVVH---------LTLERFLRGRKYEHLQVALTE---IKGTSAPSGLDRSQDK 425
            :          ..::|         .||::.|:.:..|...:.|.|   :.|.:|.|  ...::.
Mouse   154 SGNLLTIETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHLQEQRLLHGDTANS--PNLENM 216

  Fly   426 DQDQESQLSMPGSPSIATL------------SWLPPKSLDADS--IATEGDEAVDAEYVGISGAE 476
            |.|:.|.......||.|.|            |||...::|::.  .::..::::...:...:..:
Mouse   217 DLDESSLFGNLLGPSPALLDRHRLSSESSCKSWLSSLTVDSEDGYRSSMSEDSIRGAFSRQTSTD 281

  Fly   477 DEFIELPSRDTVESNMSHVLDRS 499
            ||.......|.:..|.|...:||
Mouse   282 DECFHSKDGDEILRNASSRRNRS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 26/109 (24%)
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 23/85 (27%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.