Sequence 1: | NP_001287388.1 | Gene: | CG15803 / 42206 | FlyBaseID: | FBgn0038606 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343863.1 | Gene: | mics-1 / 179475 | WormBaseID: | WBGene00011890 | Length: | 293 | Species: | Caenorhabditis elegans |
Alignment Length: | 215 | Identity: | 52/215 - (24%) |
---|---|---|---|
Similarity: | 84/215 - (39%) | Gaps: | 66/215 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 VVELHKNVYGLGITVAGYVCEEEDLS--GIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVT 372
Fly 373 NHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEI-------------------KGTSAPSG 418
Fly 419 LDRSQDK---------------------DQDQESQLS-MPGSPSI---------ATLSWLPPKSL 452
Fly 453 DADSIATEGDEAVDAEYVGI 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15803 | NP_001287388.1 | PDZ_signaling | 17..89 | CDD:238492 | |
PDZ | 307..393 | CDD:214570 | 24/84 (29%) | ||
PDZ_signaling | 605..680 | CDD:238492 | |||
PDZ | 773..858 | CDD:214570 | |||
mics-1 | NP_001343863.1 | PDZ_signaling | 71..145 | CDD:238492 | 21/73 (29%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |