DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and mics-1

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001343863.1 Gene:mics-1 / 179475 WormBaseID:WBGene00011890 Length:293 Species:Caenorhabditis elegans


Alignment Length:215 Identity:52/215 - (24%)
Similarity:84/215 - (39%) Gaps:66/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 VVELHKNVYGLGITVAGYVCEEEDLS--GIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVT 372
            |||:.|...|.|..:.|.......:.  ||:|.|:  .|.:::.|.::..|:|::.||..::..|
 Worm    73 VVEIEKTSKGFGFNIVGGTDNPHFVGDIGIYVSSV--NSESKSYGVVRTGDKILSFDGIDMTYKT 135

  Fly   373 NHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEI-------------------KGTSAPSG 418
            :.:|||:.|:..| .|:.  :.|..|:|.|||...|:.                   ..|..|..
 Worm   136 HDEAVEVFRSVKI-GHVA--KMLIDREYLHLQEDRTQTPTASVSITPQVTPQTRSTQNNTDTPKS 197

  Fly   419 LDRSQDK---------------------DQDQESQLS-MPGSPSI---------ATLSWLPPKSL 452
            :..|:.|                     ::|.:|..| .|.:.||         ..||.|.|:: 
 Worm   198 MSHSESKSRLTSHGLSAVIERIRGKVYEEEDAQSVTSYAPSTHSIIDDVPRTPRKPLSLLDPRN- 261

  Fly   453 DADSIATEGDEAVDAEYVGI 472
              :|..||      |.||.|
 Worm   262 --NSWLTE------ALYVSI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 24/84 (29%)
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
mics-1NP_001343863.1 PDZ_signaling 71..145 CDD:238492 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.