DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15803 and USH1C

DIOPT Version :9

Sequence 1:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_016872564.1 Gene:USH1C / 10083 HGNCID:12597 Length:956 Species:Homo sapiens


Alignment Length:397 Identity:70/397 - (17%)
Similarity:113/397 - (28%) Gaps:209/397 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 ETYVVELHKNVYGLGITVAG---YVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSL 368
            |..:..||..  |||::|.|   :.|      |:|:..:|:|..|::.| :|:.|.||.::|.|:
Human    87 EVRLDRLHPE--GLGLSVRGGLEFGC------GLFISHLIKGGQADSVG-LQVGDEIVRINGYSI 142

  Fly   369 SGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQL 433
            |..|:.:.:.|:|....|          ..|..|  :.|..:|                      
Human   143 SSCTHEEVINLIRTKKTV----------SIKVRH--IGLIPVK---------------------- 173

  Fly   434 SMPGSPSIATLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSHVLDR 498
            |.|..|    |:|                     :||      |:|:                  
Human   174 SSPDEP----LTW---------------------QYV------DQFV------------------ 189

  Fly   499 SDHSGGLTKDQVPRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVKDL 563
             ..|||:.                                                         
Human   190 -SESGGVR--------------------------------------------------------- 196

  Fly   564 GDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVDVECGIEKRPHHY 628
                           |.:.:|.|....:             |.:.|||.|:..:.|.|       
Human   197 ---------------GSLGSPGNRENKE-------------KKVFISLVGSRGLGCSI------- 226

  Fly   629 IRSILADGPVGRQGI---------------LRPGDELLQVNEHKLQGLRHIEVVKILKELPA-RV 677
                 :.||:.:.||               |..||::::||......|.|.|.|.:||...: .:
Human   227 -----SSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTI 286

  Fly   678 KLVCARG 684
            .:|.|.|
Human   287 SIVAAAG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 26/88 (30%)
PDZ_signaling 605..680 CDD:238492 22/90 (24%)
PDZ 773..858 CDD:214570
USH1CXP_016872564.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.