DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and ENV9

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_014889.3 Gene:ENV9 / 854420 SGDID:S000005772 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:350 Identity:98/350 - (28%)
Similarity:155/350 - (44%) Gaps:57/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDE 108
            |..::.:|.||||||:|||:.....|...|..:.:..||.....:|...|..|...|     ..|
Yeast    11 DPAVERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKR-----CHE 70

  Fly   109 DDN---------PEDRYFVEARY--LDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMP 162
            ||:         |..:......|  |||..|:.|...|.:::...:.|||||||||::....:| 
Yeast    71 DDDGSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLEM- 134

  Fly   163 TEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVK--- 224
            |:||||...|.||::.|:.|..||| |.|..:|||:.:|:..|.   ::|.......||..|   
Yeast   135 TKDGFEVQLQTNYISHFIFTMRLLP-LLRHCRGRIISLSSIGHH---LEFMYWKLSKTWDYKPNM 195

  Fly   225 ----FHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVT 285
                |.    :|.||..::..|:.:|  :|...|......||||..|..|   ...:.|.:..:.
Yeast   196 LFTWFR----YAMSKTALIQCTKMLA--IKYPDVLCLSVHPGLVMNTNLF---SYWTRLPIVGIF 251

  Fly   286 YPWM------WLFMKNAYEGAQCAIRLATDPQL--KEVTGEYF-NDCEIAASSVTGQDKELAKKL 341
            : |:      :.|..:..:|:..:::.|.||.|  ::..|:|| ...:.:.||....:.:.|...
Yeast   252 F-WLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTGGKESKSSYVSNNVDEAAST 315

  Fly   342 YMQTIKTLESVTKLTVDREEYGLDL 366
            ::.|:..|.       ||   |.|:
Yeast   316 WIWTVHQLR-------DR---GFDI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 85/296 (29%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 91/318 (29%)
ENV9NP_014889.3 NADB_Rossmann 17..318 CDD:419666 91/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.