DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and YKL107W

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:74/391 - (18%)
Similarity:146/391 - (37%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFEEADPFATWWPTIAALTVGIVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAG 71
            ||.:.||..:|                    .::..||.......|.:.||..|:|..|::.||.
Yeast     1 MFWKKDPTVSW--------------------ERKNINDIDFSRFNVAIIGGTGGLGRAISRELAQ 45

  Fly    72 RGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRY-FVEARYLDLCSLRSVHHFA 135
            |..|:                        |.:.....|::.:|:. ||:|   ||..:......:
Yeast    46 RNARV------------------------TVVGQTFRDEDLKDKINFVKA---DLSLVSECKRIS 83

  Fly   136 GQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHL--QRSEQGRI- 197
            ......:|.:..|:...|:..:..:..|.:|.|:...|:||:.:::.|.:...|  .|:::..: 
Yeast    84 HSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKKDDLP 148

  Fly   198 -LFVSAHAHQGAKIDFDDPLNVGTWSVKF-----HAREAFAHSKLCVLLATRWMARELKGTSVTV 256
             :|::.....|   ...||.::.:...|:     |.....|:..|.:....|:       |::..
Yeast   149 KVFIAGFPGNG---QVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRY-------TNIDT 203

  Fly   257 NCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWM--WLFMKNAYEGAQCAIRLATDPQLKEVTGEY 319
            ....|||::  .:.||:.|.|...:..:| .|:  |. .::|...|:....|...|.::..:|..
Yeast   204 FGLNPGLIK--TNIRNNLLGSDTYLSRIT-EWIISWT-CQSAETYAKTICTLIASPAIESRSGTM 264

  Fly   320 FNDCEIAASSVTGQDKELAKKLYMQTIKTLESVTKLTVDREEYGLDLQLEMESELRLEEPAEAEP 384
            |::...|.....|..|::.:| :|:                    :.:|.:|..||.:.|..:..
Yeast   265 FSNKGDAILPSPGLTKDVVEK-FME--------------------NSELLVEKALRNQSPFTSSN 308

  Fly   385 E 385
            |
Yeast   309 E 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 54/282 (19%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 60/303 (20%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 59/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.