DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and AT1G64590

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:361 Identity:109/361 - (30%)
Similarity:169/361 - (46%) Gaps:63/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVITVRTLMS-------GQRCPND-----NQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILAC 80
            ::.||:.|:.       |.|...|     :.::....::||..||||.|.|:.||.||.|::|..
plant     1 MIETVKHLIGSGGPSGFGSRSTADHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPA 65

  Fly    81 RNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFER- 144
            |:::..:...|.|..|.              |:....|  .:|||.||.||..|    :.:||. 
plant    66 RSVKTAEETKARILSEF--------------PDAEIIV--MHLDLSSLTSVRRF----VDDFESL 110

  Fly   145 ---IDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHL-----QRSEQGRILFVS 201
               :::|:|||| .:|:....:|||.|.....|||..||||.|||..:     |...||||:.|:
plant   111 NLPLNILINNAG-KYAHKHALSEDGVEMTFATNYLGHFLLTKLLLKKMIETAAQTGVQGRIVNVT 174

  Fly   202 AHAHQGAKIDFDDPL-NVGTWSVKFHAREAFAHSKLCVLLATRWMAREL--KGTSVTVNCCTPGL 263
            :..|.....|....| ::...:..:.|..|:|.|||..:|.|..::|.|  ...:||.||..||:
plant   175 SVVHSWFSGDMLQYLADISRNNRNYDATRAYALSKLANVLHTVELSRLLHKMDANVTANCVHPGI 239

  Fly   264 VRGTRHFRN-----SPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDC 323
            |: ||..|:     :.|:..|..|         .:|:..:.|.....:||.|:|:.|.|:||:||
plant   240 VK-TRLTRDREGVVTDLVFFLTSK---------LLKSVPQAAATTCYVATSPRLRNVCGKYFSDC 294

  Fly   324 EIAASSVTGQDKELAKKLYMQT---IKTLESVTKLT 356
            ..|.||.:|.....|::|:..:   :....|.|.|:
plant   295 NEARSSKSGSCNLKAQRLWTASDLLVSPPNSTTNLS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 89/287 (31%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 99/308 (32%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 99/307 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.