DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and AT5G53100

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_200122.1 Gene:AT5G53100 / 835390 AraportID:AT5G53100 Length:364 Species:Arabidopsis thaliana


Alignment Length:329 Identity:104/329 - (31%)
Similarity:169/329 - (51%) Gaps:48/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKR------ELGCRTPLNSLDEDDN 111
            :|||..||||.|.|:.||..|..:::|.||::|   |..:|::      ..|...|||       
plant    48 IVTGSTSGIGSETARQLAEAGAHVVMAVRNIKA---AHELIQQWQTKWSASGEGLPLN------- 102

  Fly   112 PEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGV-VFANTQMPTEDGFERHSQVNY 175
                  ::|..|||.||.||..|:....|....:.||:||||: .....|..:|||:|:|.|||:
plant   103 ------IQAMELDLLSLDSVVRFSNAWNARLAPLHVLINNAGMFAMGGAQKFSEDGYEQHMQVNH 161

  Fly   176 LAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDP--LNVGTWSVKFHAREAFAHSKLCV 238
            |||.||:.||||.|.|:.:.||:.|::..|.   :.|.||  :|..:...||.:..|::.|||..
plant   162 LAPALLSLLLLPSLIRASRSRIINVNSVMHY---VGFVDPNDMNFVSGKRKFSSLSAYSSSKLAQ 223

  Fly   239 LLATRWMARELK-GTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQC 302
            ::....:.::|. .|.::|.|.:||:|: |...|:.|.:......|:.|     |:.:..||.:.
plant   224 VMFNNVLLKKLPLETGISVVCLSPGVVQ-TNITRDLPRLVQDLYSALPY-----FIFSPQEGCRS 282

  Fly   303 AIRLATDPQL-----------KEVTGEYFN-DCEIAASSVTGQDKELAKKLYMQTIKTLESVTKL 355
            ::..|||||:           |.|...:.: :|::...|...|:.|.|.:::.:|:: |..:...
plant   283 SLFSATDPQIPNHYQKLKTNEKSVCTLFISLNCKLTNCSEEAQNVETANRVWEKTLE-LIGLPSD 346

  Fly   356 TVDR 359
            ||:|
plant   347 TVER 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 94/285 (33%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 99/310 (32%)
AT5G53100NP_200122.1 PRK06197 46..342 CDD:235737 101/319 (32%)
NADB_Rossmann 48..334 CDD:304358 99/310 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.