DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and AT5G50130

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_568721.1 Gene:AT5G50130 / 835078 AraportID:AT5G50130 Length:339 Species:Arabidopsis thaliana


Alignment Length:340 Identity:99/340 - (29%)
Similarity:160/340 - (47%) Gaps:51/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TVRTLMSGQRCPN---DNQIKEQI------------VVVTGGNSGIGFEIAQALAGRGGRIILAC 80
            |:|.| :|...||   .....||:            .::|||.||||.|.|:.||.||.|:::|.
plant     4 TLRYL-AGIAGPNGFGSRSTAEQVTQHSFFPCSHLTAIITGGTSGIGAETARVLAKRGVRVVMAV 67

  Fly    81 RNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPE-DRYFVEARYLDLCSLRSVHHFAGQLMAEFER 144
            |:::..:.....|.||              ||| |....|   :||.||.||..|..|.:::...
plant    68 RDMKKAEMVKERIIRE--------------NPEADIILFE---IDLSSLSSVARFCSQFLSQDLP 115

  Fly   145 IDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHL-----QRSEQGRILFVSAHA 204
            :::|:|||||...|.:. :|:..|.....|:|..:|||.:|:..:     :...:|||:.:|:..
plant   116 LNILINNAGVFSPNLEF-SEEKIELTFATNFLGHYLLTEMLIEKMIDTAEKSGIEGRIINLSSVI 179

  Fly   205 HQGAKID-FDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELK--GTSVTVNCCTPGLVR- 265
            |...|.| |..|..:...| :::...|:|.|||..:|..:.::::||  ..:||:|...||:|: 
plant   180 HNWVKPDCFSFPKLLHPIS-RYNGTRAYAQSKLATILHAKALSKQLKDRNANVTINAVHPGIVKT 243

  Fly   266 GTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSV 330
            |...........||.:.|..      .:|:..:||.....:|...:.|.::|:||.||.....|.
plant   244 GIIRAHKGLFTDSLFLIASK------LLKSISQGAATTCYVALSNETKGLSGKYFADCNETNCSD 302

  Fly   331 TGQDKELAKKLYMQT 345
            ...|:.:|.||..|:
plant   303 LANDEYVALKLCTQS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 82/292 (28%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 90/313 (29%)
AT5G50130NP_568721.1 retinol-DH_like_SDR_c_like 38..313 CDD:212492 88/299 (29%)
adh_short 38..245 CDD:278532 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.