DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and FEY

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_194506.4 Gene:FEY / 828890 AraportID:AT4G27760 Length:376 Species:Arabidopsis thaliana


Alignment Length:345 Identity:110/345 - (31%)
Similarity:171/345 - (49%) Gaps:43/345 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIK 94
            ||...|.:....|:.|.:   ..||||..||||.|.|:.||..|..:::|.||.:|.:......:
plant    41 ITASHLENPLPLPSVNDL---TCVVTGSTSGIGRETARQLAEAGAHVVMAVRNTKAAQELILQWQ 102

  Fly    95 RE-LGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGV-VFA 157
            .| .|...|||             :||..:||.||.||..||....|....:.||:||||: ...
plant   103 NEWSGKGLPLN-------------IEAMEIDLLSLDSVARFAEAFNARLGPLHVLINNAGMFAMG 154

  Fly   158 NTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWS 222
            ..|..:|:|:|:|.|||:|||.||:.||||.|.|....||:.|::..|....:|.|| :||.:..
plant   155 EAQKFSEEGYEQHMQVNHLAPALLSVLLLPSLIRGSPSRIINVNSVMHSVGFVDPDD-MNVVSGR 218

  Fly   223 VKFHAREAFAHSKLCVLLATRWMARELK-GTSVTVNCCTPGLVRGTRHFRN-SPLMSSLCVKAVT 285
            .|:.:...::.|||..::.:..:.::|. .|.|:|.|.:||:|. |...|: |.::.:|      
plant   219 RKYSSLIGYSSSKLAQIMFSSILFKKLPLETGVSVVCLSPGVVL-TNVARDLSRILQAL------ 276

  Fly   286 YPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFN-----------DCEIAASSVTGQDKELAK 339
            |..:..|:.:..||.:.::..|||||:.|......|           ||..|..|....:.|.|:
plant   277 YAVIPYFIFSPQEGCRSSLFSATDPQIPEYWETLKNDDWPVCPFISQDCRPANPSEEAHNTETAQ 341

  Fly   340 KLYMQTIK----TLESVTKL 355
            :::.:|::    .|::|.||
plant   342 RVWKKTLELVGLPLDAVEKL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 93/274 (34%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 100/306 (33%)
FEYNP_194506.4 SDR 61..344 CDD:330230 100/303 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.