DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and DHRS12

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001364858.1 Gene:DHRS12 / 79758 HGNCID:25832 Length:320 Species:Homo sapiens


Alignment Length:312 Identity:84/312 - (26%)
Similarity:129/312 - (41%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PND--NQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTP-L 103
            |:|  .||..::.:|||||||||...|..:|.|||.:.|.||:....:.|...|.||.|.:.. |
Human    31 PHDLEVQIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFL 95

  Fly   104 NSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFE 168
            :.:|..|..:...|||       :.:..|           ::.||:||||.: .|.:..||||.|
Human    96 HIVDLSDPKQIWKFVE-------NFKQEH-----------KLHVLINNAGCM-VNKRELTEDGLE 141

  Fly   169 RHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFAH 233
            ::...|.|..::||..|:|.|::....|::.||:......|::.:|..:..|   .|.....:|.
Human   142 KNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERT---PFDGTMVYAQ 203

  Fly   234 SK-LCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHF------------RNSPLMSSLCVKAVT 285
            :| ..|:|..||....            |.:     ||            ||...:..:..:|.|
Human   204 NKRQQVVLTERWAQGH------------PAI-----HFSSMHPGWADTPDRNEQELRKVVGEAQT 251

  Fly   286 YPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKEL 337
            ...:..|::......:|      .||     |...||.|...||..|:...|
Human   252 ASPLPRFLEIMMHEGKC------QPQ-----GHSSNDLEACWSSGGGEQNSL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 73/284 (26%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 80/302 (26%)
DHRS12NP_001364858.1 NADB_Rossmann 40..>235 CDD:419666 64/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.