DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Rdh12

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_084293.1 Gene:Rdh12 / 77974 MGIID:1925224 Length:316 Species:Mus musculus


Alignment Length:316 Identity:112/316 - (35%)
Similarity:171/316 - (54%) Gaps:36/316 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKR 95
            ::|...:|..|..:.||..::||:||.|:|||.|.|:.||.||.|:.:|||::..|:.||:.|:.
Mouse    21 SIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRA 85

  Fly    96 ELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQ 160
                          |....:..|  |.|||...:|:..||.:.:||.:::.:|:|||||:.. ..
Mouse    86 --------------DTKNSQVLV--RKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMC-PY 133

  Fly   161 MPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKF 225
            ..|.||||.|..||:|..||||:|||..|:.|...|::.:|:.||...||.|.|......:...|
Mouse   134 SKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKRYCSAF 198

  Fly   226 HAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMW 290
                |:.||||..||.||.:|:.|:||.||.....||:|. :...|||.|   ||:       :|
Mouse   199 ----AYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVL-SEITRNSYL---LCL-------LW 248

  Fly   291 L----FMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
            .    |.|:..:|||.::..|....|:.::|:||:||:....|...::|:.|::|:
Mouse   249 RLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 99/274 (36%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 106/295 (36%)
Rdh12NP_084293.1 PRK06197 39..316 CDD:235737 107/298 (36%)
NADB_Rossmann 39..307 CDD:304358 107/298 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.