DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and 1700003E16Rik

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_082224.1 Gene:1700003E16Rik / 71837 MGIID:1919087 Length:598 Species:Mus musculus


Alignment Length:166 Identity:39/166 - (23%)
Similarity:60/166 - (36%) Gaps:32/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMK--NAYE------GAQCAIR 305
            |..||.:.....|.|..|.|....:|:...  |.:...|.:|...|  :.:|      |...|.|
Mouse   416 LAQTSPSFGSNVPFLSPGFRFLPRNPIPPD--VASTPTPKLWPLAKWPSGWEREAEQLGELWAGR 478

  Fly   306 LATDPQLK---EVTG-EYFNDCEIAASSVTGQDKELAKK--LYMQTIKTLESVTKLTVDREEYGL 364
            ....||.:   |||. |..:...:||..|.....::..|  :..:|:|.:..|:......:|   
Mouse   479 TRVPPQGQEPVEVTPLEEDSGWPLAAPQVLEATSQVLWKPMVISETMKLVPGVSMWNRGTQE--- 540

  Fly   365 DLQLEMESELRLEEPAEAEPETE--TNQAADEKKWQ 398
                       |..||....|.|  |.||.:::..|
Mouse   541 -----------LLNPAVIRKEAEEGTPQAPEQQPIQ 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 21/80 (26%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 26/106 (25%)
1700003E16RikNP_082224.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
DUF4639 6..571 CDD:292118 39/166 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..396
LamG <436..>463 CDD:304605 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..571 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.