DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Dhrs13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_899109.2 Gene:Dhrs13 / 70451 MGIID:1917701 Length:376 Species:Mus musculus


Alignment Length:375 Identity:119/375 - (31%)
Similarity:183/375 - (48%) Gaps:47/375 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AALTVG-IVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEA 85
            |.|.:| .|:....|:....|.....::.:.|||||.|||||...|..||.||.|::||||:.|.
Mouse     8 AGLLLGAYVLVYYNLVKAPSCGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRER 72

  Fly    86 GKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVN 150
            |:.||..:::|.|            |.|..:..    |||.||.||..||...::...|:|||::
Mouse    73 GEAAAFDLRQESG------------NNEVIFMA----LDLASLASVQAFATAFLSSEPRLDVLIH 121

  Fly   151 NAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDF--- 212
            |||:.....   |.:.|....:||::.||||||||||.|:.....|::.||:.||:..::||   
Mouse   122 NAGISSCGR---TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRL 183

  Fly   213 DDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMS 277
            |.|: || |..:.   .|:|.|||..:|..|.:|.:|:||.||.....||.|......|:.|.. 
Mouse   184 DCPV-VG-WQQEL---RAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLRHLPGW- 242

  Fly   278 SLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
               ::.:..|..||.::....|||..:..|....::.::|.||.:|.:...|...:|.:.|::|:
Mouse   243 ---LRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSPAARDDQAAQRLW 304

  Fly   343 MQTIKTLESVTKLTVDREEYGLDLQLEMESELRLEEPAEAEPETETNQAA 392
                |..:.:..|....::...|           |||...:|...::|:|
Mouse   305 ----KATKKLAGLAPGDDDDDPD-----------EEPEPEDPRAPSSQSA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 96/273 (35%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 103/294 (35%)
Dhrs13NP_899109.2 PRK06197 31..312 CDD:235737 105/312 (34%)
retinol-DH_like_SDR_c_like 36..304 CDD:212492 103/295 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..376 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.