DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and WWOX

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens


Alignment Length:302 Identity:103/302 - (34%)
Similarity:139/302 - (46%) Gaps:37/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPED 114
            ::|||||.|||||||.|::.|..|..:||||||:.....|.:.|..|.                .
Human   125 KVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEW----------------H 173

  Fly   115 RYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPF 179
            :..|||..|||..||||.|||....|:...:.|||.|| ..||.....|:||.|...|||:|..|
Human   174 KAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNA-ATFALPWSLTKDGLETTFQVNHLGHF 237

  Fly   180 LLTHLLLPHLQRSEQGRILFVSAHAHQG-------AKIDFD--DPLNVGTWSVKFHAREAFAHSK 235
            .|..||...|.||...|::.||:.:|:.       .|:||.  .|.....|     |..|:..||
Human   238 YLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYW-----AMLAYNRSK 297

  Fly   236 LCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGA 300
            ||.:|.:..:.|.|....||.|...||      :...|.:..|..|..:.:.....|.|:..:||
Human   298 LCNILFSNELHRRLSPRGVTSNAVHPG------NMMYSNIHRSWWVYTLLFTLARPFTKSMQQGA 356

  Fly   301 QCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
            ...:..|..|:|:.:.|.|||:|.....|...|.:|.|:.|:
Human   357 ATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLW 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 93/276 (34%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 102/300 (34%)
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
WW 19..47 CDD:238122
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 103/302 (34%)
Interaction with MAPT. /evidence=ECO:0000250 125..414 103/302 (34%)
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.