DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and RDH11

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_057110.3 Gene:RDH11 / 51109 HGNCID:17964 Length:318 Species:Homo sapiens


Alignment Length:316 Identity:114/316 - (36%)
Similarity:168/316 - (53%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRE 96
            :|.::|...|.:..|:..::|||||.|:|||.|.|:.||.||.|:.||||::|.|:..|..|:..
Human    24 IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTT 88

  Fly    97 LGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQM 161
            .|.:..|                .|.|||...:|:..||...:||.:.:.||:|||||:.. ...
Human    89 TGNQQVL----------------VRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMC-PYS 136

  Fly   162 PTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFH 226
            .|.||||.|..||:|..||||||||..|:.|...||:.||:.||...:|.|.:     ....||:
Human   137 KTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHN-----LQGEKFY 196

  Fly   227 -AREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMW 290
             |..|:.||||..:|.|:.:||.|||:.||.....||.|: :...|:|..|.          |||
Human   197 NAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQ-SELVRHSSFMR----------WMW 250

  Fly   291 ----LFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
                .|:|...:|||.::..|....|:.::|.:|:||.:|..|...:::.:|::|:
Human   251 WLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 102/275 (37%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 109/296 (37%)
RDH11NP_057110.3 PRK06197 41..314 CDD:235737 110/299 (37%)
NADB_Rossmann 41..309 CDD:304358 110/299 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.