DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Rdh14

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:329 Identity:121/329 - (36%)
Similarity:176/329 - (53%) Gaps:23/329 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAALTVGIVITVRTL--MSGQRCPNDNQ---IKEQIVVVTGGNSGIGFEIAQALAGRGGRIILAC 80
            :|||...:.:..|..  .||||......   :..:.|::||.|||:|...|..|...|.|:|:.|
  Rat    11 LAALGGALWLAARRFSGSSGQRRQGGGDPGLMHGKTVLITGANSGLGRATAGELLRLGARVIMGC 75

  Fly    81 RNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERI 145
            |:....:.||..:::|||....|.. |..|..     :..:.|||.|||||..|..:|:.|..|:
  Rat    76 RDRARAEEAAGQLRQELGQAGGLGP-DATDGQ-----LVVKELDLASLRSVRAFCQELLQEEPRL 134

  Fly   146 DVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKI 210
            |||:|||| ||......||||||....||:|..||||:|||..|:.|...||:.||:..::...|
  Rat   135 DVLINNAG-VFQCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDI 198

  Fly   211 DFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGT--RHFRNS 273
            :|:|..:..:::..|    .::.|||..:|.||.:|..|:||:||||...||:||..  ||. :.
  Rat   199 NFEDLNSEQSYNKSF----CYSRSKLANILFTRELAHRLEGTNVTVNVLHPGIVRTNLGRHI-HI 258

  Fly   274 PLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELA 338
            ||::......|:    |.|.|...||||.:|.||:.|.::.|:|.||.||:.........|:.:|
  Rat   259 PLLARPLFNLVS----WAFFKTPLEGAQTSIYLASSPDVEGVSGRYFGDCKEEELLPKAMDESVA 319

  Fly   339 KKLY 342
            :||:
  Rat   320 RKLW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 104/272 (38%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 112/293 (38%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 113/297 (38%)
NADB_Rossmann 44..326 CDD:304358 113/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.