DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and rdh13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:341 Identity:127/341 - (37%)
Similarity:187/341 - (54%) Gaps:29/341 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TIAALTVGIVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLE 84
            ::....:|..|.::....|..||:...|..|.|:|||.|:|||.|.|..||.||||||:|||::.
 Frog     9 SMVGTALGGAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMG 73

  Fly    85 AGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLV 149
            ..:.||    |::..:| ||           :.|.||:|||.|.:|:..||..::.|.||:|||:
 Frog    74 KCENAA----RDIRGKT-LN-----------HNVFARHLDLASSKSIKEFAKTIINEEERVDVLI 122

  Fly   150 NNAGVVFANTQMP---TEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKID 211
            |||.|:    :.|   |||.||....||:|..||||:|||..::|||..||:.||:.||....||
 Frog   123 NNAAVM----RCPHWKTEDNFEMQFGVNHLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDID 183

  Fly   212 FDDPLNVGTW-SVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPL 275
            ||| ||   | ..|::.:.|:..|||..:|.|..:|:.|:||.:|.|...|| |..|...|::.:
 Frog   184 FDD-LN---WEKKKYNTKAAYCQSKLANVLFTNELAKRLQGTKLTANSLHPG-VADTELGRHTGM 243

  Fly   276 MSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKK 340
            ..|.....:..|..|..:|:..:.||.::.||....|:.|:|:|||..:....:....|:|.|:|
 Frog   244 HQSAFSSTILAPLFWFLVKSPKQAAQPSVYLAVAENLQGVSGKYFNALKEKEPAPQALDEESARK 308

  Fly   341 LYMQTIKTLESVTKLT 356
            |:.::.|.:.....||
 Frog   309 LWEESAKLVHLEEALT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 110/274 (40%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 117/295 (40%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 118/299 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.