DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and rdh12l

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001009912.1 Gene:rdh12l / 494176 ZFINID:ZDB-GENE-040801-48 Length:291 Species:Danio rerio


Alignment Length:307 Identity:109/307 - (35%)
Similarity:168/307 - (54%) Gaps:45/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRY 116
            |::||.|:|||.|.|..||.||.|||:|||::|..:.|...:|              |.:.....
Zfish    16 VLITGANTGIGKETAIDLAKRGARIIMACRDMEKAEAALKEVK--------------DSSGNQDV 66

  Fly   117 FVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMP---TEDGFERHSQVNYLAP 178
            |:.:  |||...:|:..||.::..|.:::::|:|||||:..    |   |.||||....||::..
Zfish    67 FISS--LDLSDSKSIRGFAEKINKEEKQVNILINNAGVMVC----PYGKTADGFEMQIGVNHMGH 125

  Fly   179 FLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVK-FHAREAFAHSKLCVLLAT 242
            ||||:|||..::||...||:.||:.|||...|:.:| :|    |.| :..::|:..|||..:|.|
Zfish   126 FLLTYLLLDLIKRSAPARIINVSSTAHQWGTINLED-IN----SEKNYDKQKAYCQSKLANVLFT 185

  Fly   243 RWMARELKGTSVTVNCCTPGLVRGT--RHFRNSPLMSSLCVKAVTYPWMWL---FMKNAYEGAQC 302
            |.:|:.|:||.||.....||:|:..  ||.       |...:||    ||.   |.|.:.:|||.
Zfish   186 RSLAKRLEGTGVTAYSLHPGVVQTDLWRHL-------SKPQQAV----MWFTKPFTKTSVQGAQT 239

  Fly   303 AIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLYMQTIKTL 349
            :|..|.||.|:..:|:|::||..|.::....|.|:|::|:..:.:.|
Zfish   240 SIYCAVDPALQTESGKYYSDCAPAKAAKAAMDDEVAQRLWELSCRML 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 99/274 (36%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 107/298 (36%)
rdh12lNP_001009912.1 PRK06197 5..291 CDD:235737 109/307 (36%)
NADB_Rossmann 13..282 CDD:304358 108/301 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.