DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and dhrs13a.1

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001007364.1 Gene:dhrs13a.1 / 492491 ZFINID:ZDB-GENE-041114-58 Length:296 Species:Danio rerio


Alignment Length:312 Identity:114/312 - (36%)
Similarity:164/312 - (52%) Gaps:31/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAI--IKRELG 98
            |...||.:..::..:.|:|||.|:|||...|..||.||.|:|||||  :.|:..||:  |:||.|
Zfish     1 MKMPRCTSTARLDGKTVIVTGANTGIGKATAMDLARRGARVILACR--DEGRAQAAVTDIQRETG 63

  Fly    99 CRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPT 163
            .:..|            |.    :|||.||:||..||...:.:..|:|:|:||||:|...   .|
Zfish    64 SKEVL------------YM----HLDLASLKSVRSFAENFLKKESRLDILINNAGLVIGG---KT 109

  Fly   164 EDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDF---DDPLNVGTWSVKF 225
            ||||.|...||:|..||||.|||..|:.....||:.||:.||...|:||   :...::|......
Zfish   110 EDGFGRMFGVNHLGHFLLTDLLLKRLKECGPSRIVTVSSMAHAWGKMDFNCINAQKDLGKGDSAL 174

  Fly   226 HAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMW 290
            .....::|||||.:|.|..:|:.||||:||.....||.:: |...|:|.:..||.:.    |...
Zfish   175 GLLMLYSHSKLCNVLFTHELAKRLKGTNVTCYSLHPGAIK-TELSRHSNIWWSLFMA----PIFL 234

  Fly   291 LFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
            ||.|:...|||.::..|....::.::|.||:.|.:...|...:|...||||:
Zfish   235 LFFKDVVSGAQTSLHCALQEGIEPLSGRYFSGCAVQNVSAKARDDAAAKKLW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 101/275 (37%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 110/296 (37%)
dhrs13a.1NP_001007364.1 PRK06196 7..294 CDD:235736 111/306 (36%)
NADB_Rossmann 14..289 CDD:304358 111/299 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.